General Information

  • ID:  hor002038
  • Uniprot ID:  P01148
  • Protein name:  Gonadoliberin-1
  • Gene name:  GNRH1
  • Organism:  Homo sapiens (Human)
  • Family:  GnRH family
  • Source:  Human
  • Expression:  NA
  • Disease:  Diseases associated with GNRH1 include Hypogonadotropic Hypogonadism 12 With Or Without Anosmia and Normosmic Congenital Hypogonadotropic Hypogonadism.
  • Comments:  NA
  • Taxonomy:  Homo (genus), Homininae (subfamily), Hominidae (family), Hominoidea (superfamily), Catarrhini (parvorder), Simiiformes (infraorder), Haplorrhini (suborder), Primates (order), Euarchontoglires (superorder), Boreoeutheria, Eutheria, Theria, Mammalia (class), Amniota, Tetrapoda, Dipnotetrapodomorpha, Sarcopterygii (superclass), Euteleostomi, Teleostomi, Gnathostomata, Vertebrata, Craniata (subphylum), Chordata (phylum), Deuterostomia, Bilateria, Eumetazoa, Metazoa (kingdom), Opisthokonta, Eukaryota (superkingdom), cellular organisms
  • GO MF:  GO:0005179 hormone activity; GO:0005183 gonadotropin hormone-releasing hormone activity; GO:0031530 gonadotropin-releasing hormone receptor binding
  • GO BP:  GO:0000003 reproduction; GO:0007165 signal transduction; GO:0007267 cell-cell signaling; GO:0010468 regulation of gene expression; GO:0045471 response to ethanol; GO:0048545 response to steroid hormone; GO:2000354 regulation of ovarian follicle development; GO:2001223 negative regulation of neuron migration
  • GO CC:  GO:0005576 extracellular region; GO:0005615 extracellular space

Sequence Information

  • Sequence:  QHWSYGLRPG
  • Length:  10(24-33)
  • Propeptide:  MKPIQKLLAGLILLTWCVEGCSSQHWSYGLRPGGKRDAENLIDSFQEIVKEVGQLAETQRFECTTHQPRSPLRDLKGALESLIEEETGQKKI
  • Signal peptide:  MKPIQKLLAGLILLTWCVEGCSS
  • Modification:  T1 Pyrrolidone carboxylic acid;T10 Glycine amide
  • Glycosylation:  NA
  • Mutagenesis:  NA

Activity

  • Function:  Stimulates the secretion of gonadotropins; it stimulates the secretion of both luteinizing and follicle-stimulating hormones.
  • Mechanism:  The 3D-structure was determined for the synthetic analog Triptorelin.
  • Cross BBB:  YES
  • Target:  GNRHR
  • Target Unid:   P30968
  • IC50:  NA
  • EC50:  NA
  • ED50:  NA
  • Kd:  NA
  • Half life:  NA

Structure

  • Disulfide bond:  NA
  • Structure ID:  AF-P01148-F1(AlphaFold_DB_ID)
  • Structure: (PDB_ID-from https://www.rcsb.org/; AlphaFold_DB_ID-from https://alphafold.ebi.ac.uk/; hordbxxxxxx_AF2.pdb was predicted structure by AlphaFold2; hordbxxxxxx_ESM.pdb was predicted structure by ESMFold)
  •    hor002038_AF2.pdbhor002038_ESM.pdb

Physical Information

Mass: 136103 Formula: C55H77N17O14
Absent amino acids: ACDEFIKMNTV Common amino acids: G
pI: 9.35 Basic residues: 2
Polar residues: 4 Hydrophobic residues: 2
Hydrophobicity: -128 Boman Index: -1953
Half-Life / Aliphatic Index: 0.8 hour Aliphatic Index: 39
Instability Index: 3615 Extinction Coefficient cystines: 6990
Absorbance 280nm: 776.67

Literature

  • PubMed ID:  6760865
  • Title:  The Chemical Identity of the Immunoreactive LHRH-like Peptide Biosynthesized in the Human Placenta